PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG015486t1
Common NameTCM_015486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 575aa    MW: 64691.1 Da    PI: 9.5112
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG015486t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65.1e-192983256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +++++f++eq++ Le+ Fe++ ++  +++ +LA+ lgL+ rqV +WFqNrRa++k
  Thecc1EG015486t1 29 KNKRRFSDEQIRLLESIFESETKLEPRKKLQLARDLGLQPRQVAIWFQNRRARWK 83
                      56789*************************************************9 PP

2HD-ZIP_I/II122.52e-3930121293
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       +krr+s+eq++lLE+ Fe+e+kLep++K +lar+Lglqprqva+WFqnrRAR+k+kq+E+dy++L+++yd+l+++ e+L+ke+++L  +l++
  Thecc1EG015486t1  30 NKRRFSDEQIRLLESIFESETKLEPRKKLQLARDLGLQPRQVAIWFQNRRARWKSKQIEQDYRTLRANYDNLASRFESLKKEKQTLMLQLQS 121
                       79************************************************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-191484IPR009057Homeodomain-like
SuperFamilySSF466891.45E-181886IPR009057Homeodomain-like
PROSITE profilePS5007118.1882585IPR001356Homeobox domain
SMARTSM003893.0E-182789IPR001356Homeobox domain
PfamPF000461.8E-162983IPR001356Homeobox domain
CDDcd000865.54E-153486No hitNo description
PRINTSPR000315.1E-55665IPR000047Helix-turn-helix motif
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PRINTSPR000315.1E-56581IPR000047Helix-turn-helix motif
PfamPF021834.8E-1585126IPR003106Leucine zipper, homeobox-associated
Gene3DG3DSA:3.20.20.1003.3E-73253561IPR023210NADP-dependent oxidoreductase domain
CDDcd066609.48E-77254556IPR023210NADP-dependent oxidoreductase domain
SuperFamilySSF514302.75E-70254559IPR023210NADP-dependent oxidoreductase domain
PfamPF002481.3E-61258556IPR023210NADP-dependent oxidoreductase domain
PRINTSPR000692.9E-5289313IPR020471Aldo/keto reductase
PROSITE patternPS000620391408IPR018170Aldo/keto reductase, conserved site
PRINTSPR000692.9E-5391408IPR020471Aldo/keto reductase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009443Biological Processpyridoxal 5'-phosphate salvage
GO:0042821Biological Processpyridoxal biosynthetic process
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0009507Cellular Componentchloroplast
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0050236Molecular Functionpyridoxine:NADP 4-dehydrogenase activity
GO:0070402Molecular FunctionNADPH binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MEREYHPAAH EEVAEQPPQT PRKKKNKMKN KRRFSDEQIR LLESIFESET KLEPRKKLQL  60
ARDLGLQPRQ VAIWFQNRRA RWKSKQIEQD YRTLRANYDN LASRFESLKK EKQTLMLQLQ  120
SLSKLLAEPH DINKDRKGLD TGGGSESGDT KCEPEAEAQP SIQQAGVEDR GFLGLQIEND  180
RDIEHAAQPG DEFMSMDGYR NDSPASPEKL CGFDSSACIT CLSSSNRFAL PSSPIKSLKF  240
PLFWPWQRVK VGPLTVSPMG FGTWAWGNQL LWGYKQSMDS ELEQVFNLAV ENGINLFDTA  300
DSYGTGRLNG QSEKLLGKFI REFRGEKRIE DEIVIATKFA AYPWRLTPGQ FVQACRASRD  360
RMQIEQIGIG QLHWSTANYA PPQELALWGG LVAMYEQGLV KAVGVSNYGP KQLVKIYDYL  420
KARGVPLCSA QVQFSLLSKG EVQMEIKNIC DSLGIRLISY SPLGLGMLTG KYTPSRLPSG  480
PRGLLFKQIL PGLEPLLVSL REIAEKRSKT VPQVAINWCI SKGTIPIPGV KSVKQAQENL  540
GALGWRLSSN ELLQLDCAAQ QSPRRMIQNI FQTK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3uyi_A7e-282485674324Perakine reductase
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12132RKKKNKMKNKRR
27785RRARWKSKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039171.10.0NAD(P)-linked oxidoreductase superfamily protein
SwissprotQ56Y420.0PLR1_ARATH; Pyridoxal reductase, chloroplastic
TrEMBLA0A061G3E00.0A0A061G3E0_THECC; NAD(P)-linked oxidoreductase superfamily protein
STRINGPOPTR_0015s00930.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.11e-36homeobox 12
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]